Products

cDNA Clones (10)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone
RC223988

USD 420.00

In Stock

MAP3K2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone
RG223988

USD 460.00

In Stock

MAP3K2 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone
RC223988L3

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone Lentiviral Particle
RC223988L3V

USD 820.00

5 Weeks

Lenti ORF particles, MAP3K2 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone
RC223988L4

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK2 (MAP3K2) (NM_006609) Human Untagged Clone
SC115980

USD 760.00

In Stock

MAP3K2 (untagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MEKK2 (MAP3K2) (NM_006609) Human Tagged ORF Clone
RC223988L2

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MEKK2 (MAP3K2) Rabbit Polyclonal Antibody
TA350774

USD 345.00

In Stock

Rabbit Polyclonal Anti-MAP3K2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP3K2
MEKK2 (MAP3K2) (NM_006609) Human Over-expression Lysate
LC416533

USD 187.00

In Stock

MAP3K2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MEKK2 (MAP3K2) Rabbit Polyclonal Antibody
TA331028

USD 375.00

5 Days

Rabbit polyclonal Anti-MAP3K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
MEKK2 (MAP3K2) (NM_006609) Human Mass Spec Standard
PH323988

USD 2,055.00

3 Weeks

MAP3K2 MS Standard C13 and N15-labeled recombinant protein (NP_006600)

Tag C-Myc/DDK
Expression Host HEK293
MEKK2 (MAP3K2) (NM_006609) ICC Control Block
TB423988

USD 1,070.00

4 Weeks

Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MEKK2 (MAP3K2) Cytosection
TS423988

USD 225.00

4 Weeks

Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MEKK2 (MAP3K2) Cytosection
TS423988P5

USD 889.00

4 Weeks

Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack