Germany
Japan
United Kingdom
China
BMP8A (Myc-DDK-tagged)-Human bone morphogenetic protein 8a (BMP8A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human bone morphogenetic protein 8a (BMP8A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BMP8A (Myc-DDK tagged) - Human bone morphogenetic protein 8a (BMP8A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bone morphogenetic protein 8a (BMP8A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BMP8A (mGFP-tagged) - Human bone morphogenetic protein 8a (BMP8A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BMP8A (GFP-tagged) - Human bone morphogenetic protein 8a (BMP8A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BMP8A (untagged)-Human bone morphogenetic protein 8a (BMP8A)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of bone morphogenetic protein 8a (BMP8A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
BMP8A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-BMP8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG |
Rabbit Polyclonal Anti-BMP8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8A. Synthetic peptide located within the following region: RPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPL |
Transient overexpression of BMP8A (NM_181809) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BMP8A (NM_181809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BMP8A (NM_181809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BMP8A
Pathways
- Hedgehog signaling pathway