WNT8B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 8B (WNT8B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT8B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 8B (WNT8B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT8B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT8B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT8B (GFP-tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT8B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT8B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WNT8B (untagged)-Human wingless-type MMTV integration site family, member 8B (WNT8B)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of wingless-type MMTV integration site family, member 8B (WNT8B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-WNT8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WNT8B Antibody: synthetic peptide directed towards the middle region of human WNT8B. Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG |
WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%). |
Rabbit Polyclonal Anti-Wnt8b Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Wnt8b Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE |
WNT8B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-WNT8B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8B |
Transient overexpression of WNT8B (NM_003393) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human wingless-type MMTV integration site family, member 8B (WNT8B), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug
Tag | N-GST and C-HIS |
Expression Host | E. coli |
Transient overexpression of WNT8B (NM_003393) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT8B (NM_003393) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack