Products

View as table Download

USD 98.00

USD 390.00

In Stock

EPO (Myc-DDK-tagged)-Human erythropoietin (EPO)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, EPO (Myc-DDK tagged) - Human erythropoietin (EPO), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

EPO (untagged)-Human erythropoietin (EPO)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

EPO (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin.

EPO (GFP-tagged) - Human erythropoietin (EPO)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human erythropoietin (EPO), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human erythropoietin (EPO)

Tag Tag Free
Expression Host CHO

Lenti ORF clone of Human erythropoietin (EPO), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human erythropoietin (EPO), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-EPO Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPO

Erythropoietin / EPO (alpha) human recombinant protein, 50 µg

Erythropoietin / EPO human recombinant protein, 50 µg

Expression Host CHO

Erythropoietin / EPO human recombinant protein, 10 µg

Expression Host CHO

Erythropoietin / EPO (28-193, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host Insect

Erythropoietin / EPO (28-193, His-tag) human protein, 50 µg

Tag His-tag
Expression Host Insect

Rabbit Polyclonal Anti-EPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

Rabbit Polyclonal Anti-EPO Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO

Lenti ORF clone of Human erythropoietin (EPO), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

EPO mouse monoclonal antibody, clone Epo2

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Purified recombinant protein of Human erythropoietin (EPO), Ala28-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Erythropoietin / EPO (28-193, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

Erythropoietin / EPO (28-193, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) EPO mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human
Conjugation Unconjugated

EPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-EPO Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPO

EPO mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human
Conjugation Unconjugated

EPO mouse monoclonal antibody,clone OTI5D8, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

EPO mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human
Conjugation Unconjugated

USD 1,040.00

4 Weeks

Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack