Products

Primary Antibodies (45)
View as table Download

Rabbit polyclonal ASPA Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA.

Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381)

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the N terminal of human ASPA. Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the middle region of human ASPA. Synthetic peptide located within the following region: IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ASPA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASPA

ASPA mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated