Products

View as table Download

METTL2B (Myc-DDK-tagged)-Human methyltransferase like 2B (METTL2B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human methyltransferase like 2B (METTL2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human methyltransferase like 2B (METTL2B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

METTL2B (GFP-tagged) - Human methyltransferase like 2B (METTL2B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-METTL2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Rabbit Polyclonal Anti-METTL2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS

Lenti ORF clone of Human methyltransferase like 2B (METTL2B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

METTL2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of methyltransferase like 2B (METTL2B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

METTL2B MS Standard C13 and N15-labeled recombinant protein (NP_060866)

Tag C-Myc/DDK
Expression Host HEK293

METTL2B (untagged)-Human methyltransferase like 2B (METTL2B)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack