METTL2B (Myc-DDK-tagged)-Human methyltransferase like 2B (METTL2B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
METTL2B (Myc-DDK-tagged)-Human methyltransferase like 2B (METTL2B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, METTL2B (Myc-DDK tagged) - Human methyltransferase like 2B (METTL2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, METTL2B (mGFP-tagged) - Human methyltransferase like 2B (METTL2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human methyltransferase like 2B (METTL2B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, METTL2B (Myc-DDK tagged) - Human methyltransferase like 2B (METTL2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human methyltransferase like 2B (METTL2B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, METTL2B (mGFP-tagged) - Human methyltransferase like 2B (METTL2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
METTL2B (GFP-tagged) - Human methyltransferase like 2B (METTL2B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human methyltransferase like 2B (METTL2B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-METTL2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE |
Rabbit Polyclonal Anti-METTL2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS |
Lenti ORF clone of Human methyltransferase like 2B (METTL2B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
METTL2B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of methyltransferase like 2B (METTL2B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
METTL2B MS Standard C13 and N15-labeled recombinant protein (NP_060866)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
METTL2B (untagged)-Human methyltransferase like 2B (METTL2B)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of METTL2B (NM_018396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack