Products

Proteins (7)
cDNA Clones (7)
Antibodies (2)
Jump to Filters
View as table Download
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone
RC208923

USD 420.00

In Stock

TRMT11 (Myc-DDK-tagged)-Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone
RG208923

USD 460.00

In Stock

TRMT11 (GFP-tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone
RC208923L3

USD 620.00

3 Weeks

Lenti ORF clone of Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone Lentiviral Particle
RC208923L3V

USD 820.00

6 Weeks

Lenti ORF particles, TRMT11 (Myc-DDK tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone
RC208923L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRM11 (TRMT11) (NM_001031712) Human Tagged ORF Clone Lentiviral Particle
RC208923L4V

USD 820.00

6 Weeks

Lenti ORF particles, TRMT11 (mGFP-tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRM11 (TRMT11) Rabbit Polyclonal Antibody
TA346691

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRMT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP
TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate
LC422163

USD 121.00

In Stock

TRMT11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate
LY422163

USD 396.00

In Stock

Transient overexpression lysate of tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TRM11 (TRMT11) (NM_001031712) Human Untagged Clone
SC322690

USD 760.00

In Stock

TRMT11 (untagged)-Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TRM11 (TRMT11) Rabbit Polyclonal Antibody
TA315701

USD 345.00

4 Weeks

Rabbit polyclonal anti-TRMT11 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TRMT11.
TRM11 (TRMT11) (NM_001031712) Human Mass Spec Standard
PH308923

USD 2,055.00

3 Weeks

TRMT11 MS Standard C13 and N15-labeled recombinant protein (NP_001026882)

Tag C-Myc/DDK
Expression Host HEK293
TRM11 (TRMT11) (NM_001031712) ICC Control Block
TB408923

USD 1,070.00

4 Weeks

Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TRM11 (TRMT11) Cytosection
TS408923

USD 225.00

4 Weeks

Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TRM11 (TRMT11) Cytosection
TS408923P5

USD 889.00

4 Weeks

Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack