Products

cDNA Clones (7)
Proteins (4)
Antibodies (3)
Jump to Filters
View as table Download
COX7B (NM_001866) Human Tagged ORF Clone
RC201999

USD 98.00

USD 390.00

In Stock

COX7B (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
COX7B (NM_001866) Human Tagged ORF Clone
RG201999

USD 460.00

In Stock

COX7B (GFP-tagged) - Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
COX7B (NM_001866) Human Tagged ORF Clone
RC201999L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
COX7B (NM_001866) Human Tagged ORF Clone Lentiviral Particle
RC201999L3V

USD 820.00

6 Weeks

Lenti ORF particles, COX7B (Myc-DDK tagged) - Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
COX7B (NM_001866) Human Tagged ORF Clone
RC201999L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
COX7B (NM_001866) Human Tagged ORF Clone Lentiviral Particle
RC201999L4V

USD 820.00

6 Weeks

Lenti ORF particles, COX7B (mGFP-tagged) - Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
COX7B (NM_001866) Human Untagged Clone
SC118991

USD 310.00

In Stock

COX7B (untagged)-Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
COX7B (NM_001866) Human Recombinant Protein
TP761218

USD 215.00

In Stock

Purified recombinant protein of Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
COX7B Rabbit Polyclonal Antibody
TA340027

USD 375.00

5 Days

Rabbit Polyclonal Anti-COX7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX7B antibody: synthetic peptide directed towards the N terminal of human COX7B. Synthetic peptide located within the following region: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI
COX7B Rabbit Polyclonal Antibody
TA323104

USD 345.00

4 Weeks

Anti-COX7B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb
COX7B Rabbit Polyclonal Antibody
TA323105

USD 345.00

In Stock

Anti-COX7B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb
COX7B ICC Control Block
TB401999

USD 1,040.00

4 Weeks

Transient overexpression of COX7B (NM_001866) in HEK293T cells paraffin embedded controls for ICC/IHC staining

COX7B Cytosection
TS401999

USD 225.00

4 Weeks

Transient overexpression of COX7B (NM_001866) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

COX7B Cytosection
TS401999P5

USD 889.00

4 Weeks

Transient overexpression of COX7B (NM_001866) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack