Germany
Japan
United Kingdom
China
CACNA2D4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CACNA2D4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CACNA2D4 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CACNA2D4 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNA2D4 (untagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D4 antibody: synthetic peptide directed towards the C terminal of human CACNA2D4. Synthetic peptide located within the following region: MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS |
CACNA2D4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 4 (CACNA2D4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of CACNA2D4 (NM_172364) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNA2D4 (NM_172364) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CACNA2D4 (NM_172364) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CACNA2D4
Pathways
- Hypertrophic cardiomyopathy (HCM)