CACNA2D4 Rabbit Polyclonal Antibody

CAT#: TA337800

Rabbit Polyclonal Anti-CACNA2D4 Antibody

Product Images

Host: Rabbit; Target Name: CACNA2D4; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit alpha2delta 4
• Database Link:
  NP_758952
  Entrez Gene 93589 Human
  UniProt ID Q7Z3S7
• Background: The function of this protein remains unknown.
• Synonyms: RCD4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway