Germany
Japan
United Kingdom
China
FBP2 (Myc-DDK-tagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
FBP2 (GFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FBP2 (Myc-DDK tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FBP2 (mGFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FBP2 (1-339, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
FBP2 (1-339, His-tag) human protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ |
FBP2 mouse monoclonal antibody, clone AT1E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
FBP2 mouse monoclonal antibody, clone AT1E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
FBP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FBP2 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FBP2 |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY |
FBP2 (1-339, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
FBP2 (1-339, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of fructose-1,6-bisphosphatase 2 (FBP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FBP2 (untagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBP2 |
Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- FBP2
Pathways
- Insulin signaling pathway