Lenti ORF particles, SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SHC3 (GFP-tagged) - Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SHC3 (untagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SHC3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST |
Rabbit Polyclonal Anti-SHC3 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Shc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS |
Lenti-ORF clone of SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal SHC3 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SHC3. |
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack