SOCS1 (Myc-DDK-tagged)-Human suppressor of cytokine signaling 1 (SOCS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SOCS1 (Myc-DDK-tagged)-Human suppressor of cytokine signaling 1 (SOCS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SOCS1 (GFP-tagged) - Human suppressor of cytokine signaling 1 (SOCS1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SOCS1 (Myc-DDK tagged) - Human suppressor of cytokine signaling 1 (SOCS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SOCS1 (mGFP-tagged) - Human suppressor of cytokine signaling 1 (SOCS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Transient overexpression lysate of suppressor of cytokine signaling 1 (SOCS1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human suppressor of cytokine signaling 1 (SOCS1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOCS1 (Myc-DDK tagged) - Human suppressor of cytokine signaling 1 (SOCS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human suppressor of cytokine signaling 1 (SOCS1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOCS1 (mGFP-tagged) - Human suppressor of cytokine signaling 1 (SOCS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SOCS1 (untagged)-Human suppressor of cytokine signaling 1 (SOCS1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
SOCS1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Goat Polyclonal Antibody against SOCS1
Applications | FC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VLRDYLSSFPFQI, from the C Terminus of the protein sequence according to NP_003736.1. |
Rabbit Polyclonal SOCS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1. |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
SOCS1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human SOCS1 |
Lenti ORF clone of Human suppressor of cytokine signaling 1 (SOCS1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human suppressor of cytokine signaling 1 (SOCS1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal SOCS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SOCS1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human SOCS1. |
SOCS1 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human SOCS1 |
SOCS1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal SOCS-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 54-68 (HFRTFRSHADYRRIT) of human SOCS1 was used as immunogen (NP_003736.1) |
Rabbit anti SOCS1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminus of SOCS-1 protein from human and mouse origins. |
SOCS1 MS Standard C13 and N15-labeled recombinant protein (NP_003736)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-SOCS1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1 |
Anti-SOCS1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1 |
Rabbit polyclonal anti-SOCS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOCS1 |
Rabbit polyclonal anti-SOCS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOCS1 |
Transient overexpression of SOCS1 (NM_003745) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SOCS1 (NM_003745) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SOCS1 (NM_003745) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack