SOCS1 Rabbit Polyclonal Antibody

CAT#: TA346365

Rabbit Polyclonal Anti-SOCS1 Antibody

Product Images

WB Suggested Anti-SOCS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: suppressor of cytokine signaling 1
• Database Link:
  NP_003736
  Entrez Gene 252971 RatEntrez Gene 8651 Human
  UniProt ID O15524
• Background: SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
• Synonyms: CIS1; CISH1; JAB; SOCS-1; SSI-1; SSI1; TIP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway
• Protein Pathways: Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus, Ubiquitin mediated proteolysis