Products

cDNA Clones (14)
Proteins (11)
Antibodies (6)
Jump to Filters
View as table Download
Cardiotrophin 1 (CTF1) (NM_001330) Human Tagged ORF Clone
RC207800

USD 420.00

In Stock

CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cardiotrophin 1 (CTF1) (NM_001330) Human Tagged ORF Clone
RC207800L4

USD 620.00

3 Weeks

Lenti-ORF clone of CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cardiotrophin 1 (CTF1) (NM_001142544) Human Tagged ORF Clone
RC227238

USD 420.00

3 Weeks

CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cardiotrophin 1 (CTF1) (NM_001142544) Human Tagged ORF Clone Lentiviral Particle
RC227238L3V

USD 820.00

6 Weeks

Lenti ORF particles, CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cardiotrophin 1 (CTF1) (NM_001330) Human Tagged ORF Clone
RG207800

USD 460.00

3 Weeks

CTF1 (GFP-tagged) - Human cardiotrophin 1 (CTF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cardiotrophin 1 (CTF1) (NM_001142544) Human Tagged ORF Clone
RG227238

USD 460.00

3 Weeks

CTF1 (GFP-tagged) - Human cardiotrophin 1 (CTF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cardiotrophin 1 (CTF1) (NM_001330) Human Untagged Clone
SC125788

USD 310.00

In Stock

CTF1 (untagged)-Human cardiotrophin 1 (CTF1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cardiotrophin 1 (CTF1) (NM_001330) Human Recombinant Protein
TP723052

USD 240.00

2 Weeks

Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1.

Tag Tag Free
Expression Host E. coli
Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody
AP20766PU-N

USD 407.00

2 Weeks

Cardiotrophin 1 (CTF1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody
TA328276

USD 285.00

5 Days

Anti-Human Cardiotrophin-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Cardiotrophin-1
Cardiotrophin 1 (CTF1) (C-term) Rabbit Polyclonal Antibody
AP51121PU-N

USD 450.00

2 Weeks

Cardiotrophin 1 (CTF1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 165-194 amino acids from the C-terminal region of Human CTF1.
Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody
TA328275

USD 285.00

5 Days

Biotinylated Anti-Human Cardiotrophin-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Cardiotrophin-1
Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody
TA340012

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody
TA340013

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG
Cardiotrophin-1 (His-tagged) Human Protein
PA504X

USD 505.00

2 Weeks

Cardiotrophin-1 (His-tagged) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Cardiotrophin 1 (CTF1) ICC Control Block
TB407800

USD 1,070.00

4 Weeks

Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cardiotrophin 1 (CTF1) ICC Control Block
TB427238

USD 1,070.00

4 Weeks

Transient overexpression of CTF1 (NM_001142544) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cardiotrophin 1 (CTF1) (NM_001330) Human Recombinant Protein
TP721146

USD 330.00

3 Weeks

Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1

Tag N-His
Expression Host E. coli
Cardiotrophin 1 (CTF1) (NM_001330) Human Recombinant Protein
TP721146L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1

Tag N-His
Expression Host E. coli
Cardiotrophin 1 (CTF1) (NM_001330) Human Recombinant Protein
TP721146M

USD 760.00

3 Weeks

Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1

Tag N-His
Expression Host E. coli
Cardiotrophin 1 (CTF1) (NM_001330) Human Recombinant Protein
TP721146XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1

Tag N-His
Expression Host E. coli
Cardiotrophin 1 (CTF1) Cytosection
TS407800

USD 225.00

4 Weeks

Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cardiotrophin 1 (CTF1) Cytosection
TS407800P5

USD 889.00

4 Weeks

Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cardiotrophin 1 (CTF1) ICC Control Sections
TS427238P5

USD 889.00

4 Weeks

Transient overexpression of CTF1 (NM_001142544) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack