IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL5 (GFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL5 (Myc-DDK tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL5 (mGFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5).
Tag | Tag Free |
Expression Host | E. coli |
IL5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5 |
IL5 (untagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Anti-Human IL-5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-5 |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Biotinylated Anti-Human IL-5 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-5 |
Rabbit Polyclonal Anti-IL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Mouse Monoclonal Anti-IL-5 Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human |
Conjugation | Unconjugated |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Tag | C-His |
Expression Host | HEK293 |
IL5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug
Tag | C-HIS |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack