ACTN2 (Myc-DDK-tagged)-Human actinin, alpha 2 (ACTN2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACTN2 (Myc-DDK-tagged)-Human actinin, alpha 2 (ACTN2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human actinin, alpha 2 (ACTN2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ACTN2 (Myc-DDK tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ACTN2 (mGFP-tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, ACTN2 (Myc-DDK tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACTN2 (mGFP-tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACTN2 (myc-DDK-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACTN2 (myc-DDK-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ACTN2 (untagged)-Human actinin, alpha 2 (ACTN2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ACTN2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal Actinin alpha-2/3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3. |
Rabbit Polyclonal Anti-Actinin a 2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actinin a 2/3 Antibody: A synthesized peptide derived from human Actinin a 2/3 |
ACTN2 (11-347) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 11 and 347 of alpha Actinin 2 |
ACTN2 (215-500) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 215 and 500 of actinin, alpha 2 |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ACTN2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of actinin, alpha 2 (ACTN2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ACTN2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 750-779 amino acids from the C-terminal region of human ACTN2 |
ACTN2 MS Standard C13 and N15-labeled recombinant protein (NP_001094)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ACTN2 (untagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ACTN2 (untagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ACTN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACTN2 |
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001278344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001278343) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACTN2 (NM_001278344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACTN2 (NM_001278343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack