Products

View as table Download

Recombinant protein of human actinin, alpha 4 (ACTN4)

Tag C-Myc/DDK
Expression Host HEK293T

ACTN4 (GFP-tagged) - Human actinin, alpha 4 (ACTN4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ACTN4 (untagged)-Human actinin, alpha 4 (ACTN4)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

alpha Actinin 4 (ACTN4) mouse monoclonal antibody, clone 4D10, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-ACTN4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACTN4.

ACTN4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ACTN4 MS Standard C13 and N15-labeled recombinant protein (NP_004915)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTN4

Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack