ACTN4 (Myc-DDK-tagged)-Human actinin, alpha 4 (ACTN4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACTN4 (Myc-DDK-tagged)-Human actinin, alpha 4 (ACTN4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human actinin, alpha 4 (ACTN4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, ACTN4 (Myc-DDK tagged) - Human actinin, alpha 4 (ACTN4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, ACTN4 (mGFP-tagged) - Human actinin, alpha 4 (ACTN4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ACTN4 (GFP-tagged) - Human actinin, alpha 4 (ACTN4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ACTN4 (untagged)-Human actinin, alpha 4 (ACTN4)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human actinin, alpha 4 (ACTN4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, ACTN4 (Myc-DDK tagged) - Human actinin, alpha 4 (ACTN4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, ACTN4 (mGFP-tagged) - Human actinin, alpha 4 (ACTN4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Transient overexpression lysate of actinin, alpha 4 (ACTN4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
alpha Actinin 4 (ACTN4) mouse monoclonal antibody, clone 4D10, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-ACTN4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACTN4. |
ACTN4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ACTN4 MS Standard C13 and N15-labeled recombinant protein (NP_004915)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTN4 |
Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACTN4 (NM_004924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack