Products

cDNA Clones (30)
Proteins (17)
Antibodies (1)
Jump to Filters
View as table Download
CTNNA2 (NM_004389) Human Tagged ORF Clone
RC208731

USD 750.00

In Stock

CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTNNA2 (NM_004389) Human Tagged ORF Clone Lentiviral Particle
RC208731L1V

USD 1,150.00

3 Weeks

Lenti ORF particles, CTNNA2 (Myc-DDK tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone Lentiviral Particle
RC208731L2V

USD 1,150.00

6 Weeks

Lenti ORF particles, CTNNA2 (mGFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone
RG208731

USD 830.00

In Stock

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone
RC208731L3

USD 950.00

3 Weeks

Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone Lentiviral Particle
RC208731L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, CTNNA2 (Myc-DDK tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone
RC208731L4

USD 950.00

3 Weeks

Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone Lentiviral Particle
RC208731L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, CTNNA2 (mGFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone
RC228598

USD 960.00

4 Weeks

CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone
RC228598L3

USD 1,160.00

4 Weeks

Lenti-ORF clone of CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone Lentiviral Particle
RC228598L3V

USD 1,360.00

7 Weeks

Lenti ORF particles, CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone
RC228598L4

USD 1,160.00

4 Weeks

Lenti-ORF clone of CTNNA2 (mGFP-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone Lentiviral Particle
RC228598L4V

USD 1,360.00

7 Weeks

Lenti ORF particles, CTNNA2 (mGFP-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTNNA2 (NM_001282600) Human Tagged ORF Clone
RC238786

USD 480.00

3 Weeks

CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282599) Human Tagged ORF Clone
RC238985

USD 480.00

3 Weeks

CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282598) Human Tagged ORF Clone
RC239805

USD 750.00

4 Weeks

CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282597) Human Tagged ORF Clone
RC239818

USD 750.00

4 Weeks

CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001164883) Human Tagged ORF Clone
RG228598

USD 1,060.00

5 Weeks

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone
RC208731L1

USD 950.00

In Stock

Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CTNNA2 (NM_004389) Human Tagged ORF Clone
RC208731L2

USD 950.00

3 Weeks

Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CTNNA2 (NM_004389) Human Untagged Clone
SC117392

USD 310.00

In Stock

CTNNA2 (untagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CTNNA2 (NM_004389) Human Over-expression Lysate
LC418015

USD 121.00

In Stock

CTNNA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTNNA2 Rabbit Polyclonal Antibody
TA338188

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTNNA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS
CTNNA2 (NM_004389) Human Over-expression Lysate
LY418015

USD 396.00

5 Days

Transient overexpression lysate of catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTNNA2 (NM_004389) Human Mass Spec Standard
PH308731

USD 2,055.00

3 Weeks

CTNNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004380)

Tag C-Myc/DDK
Expression Host HEK293
CTNNA2 (NM_001282600) Human Tagged ORF Clone
RG238786

USD 520.00

2 Weeks

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282599) Human Tagged ORF Clone
RG238985

USD 520.00

2 Weeks

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282598) Human Tagged ORF Clone
RG239805

USD 790.00

2 Weeks

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001282597) Human Tagged ORF Clone
RG239818

USD 790.00

2 Weeks

CTNNA2 (GFP-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTNNA2 (NM_001164883) Human Untagged Clone
SC327233

USD 1,750.00

5 Weeks

CTNNA2 (untagged)-Human catenin (cadherin-associated protein) alpha 2 (CTNNA2) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CTNNA2 (NM_001282600) Human Untagged Clone
SC336680

USD 540.00

3 Weeks

CTNNA2 (untagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CTNNA2 (NM_001282599) Human Untagged Clone
SC336879

USD 600.00

3 Weeks

CTNNA2 (untagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CTNNA2 (NM_001282598) Human Untagged Clone
SC337699

USD 960.00

4 Weeks

CTNNA2 (untagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CTNNA2 (NM_001282597) Human Untagged Clone
SC337712

USD 970.00

4 Weeks

CTNNA2 (untagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CTNNA2 ICC Control Block
TB408731

USD 1,400.00

4 Weeks

Transient overexpression of CTNNA2 (NM_004389) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 ICC Control Block
TB428598

USD 1,610.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001164883) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 ICC Control Block
TB438786

USD 1,130.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282600) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 ICC Control Block
TB438985

USD 1,130.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282599) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 ICC Control Block
TB439805

USD 1,400.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282598) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 ICC Control Block
TB439818

USD 1,400.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282597) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTNNA2 Cytosection
TS408731

USD 225.00

4 Weeks

Transient overexpression of CTNNA2 (NM_004389) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CTNNA2 Cytosection
TS408731P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_004389) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTNNA2 ICC Control Sections
TS428598P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001164883) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTNNA2 ICC Control Sections
TS438786P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282600) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTNNA2 ICC Control Sections
TS438985P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282599) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTNNA2 ICC Control Sections
TS439805P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282598) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTNNA2 ICC Control Sections
TS439818P5

USD 889.00

4 Weeks

Transient overexpression of CTNNA2 (NM_001282597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack