Products

cDNA Clones (34)
Proteins (24)
Antibodies (4)
Jump to Filters
View as table Download
RAP1B (NM_015646) Human Tagged ORF Clone
RC221678

USD 420.00

In Stock

RAP1B (Myc-DDK-tagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RAP1B (NM_001010942) Human Tagged ORF Clone
RC221793

USD 420.00

In Stock

RAP1B (Myc-DDK-tagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RAP1B (NM_015646) Human Tagged ORF Clone Lentiviral Particle
RC221678L1V

USD 820.00

3 Weeks

Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone Lentiviral Particle
RC221678L2V

USD 820.00

6 Weeks

Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone Lentiviral Particle
RC221793L1V

USD 820.00

3 Weeks

Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone Lentiviral Particle
RC221793L2V

USD 820.00

6 Weeks

Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone
RC221678L3

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone Lentiviral Particle
RC221678L3V

USD 820.00

5 Weeks

Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone
RC221678L4

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone Lentiviral Particle
RC221678L4V

USD 820.00

7 Weeks

Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone
RC221793L3

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone Lentiviral Particle
RC221793L3V

USD 820.00

6 Weeks

Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone
RC221793L4

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone Lentiviral Particle
RC221793L4V

USD 820.00

6 Weeks

Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAP1B (NM_001251922) Human Tagged ORF Clone
RC231782

USD 420.00

3 Weeks

RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251917) Human Tagged ORF Clone
RC231805

USD 420.00

3 Weeks

RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251918) Human Tagged ORF Clone
RC231806

USD 420.00

3 Weeks

RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251921) Human Tagged ORF Clone
RC231928

USD 420.00

3 Weeks

RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_015646) Human Tagged ORF Clone
RG221678

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001010942) Human Tagged ORF Clone
RG221793

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251922) Human Tagged ORF Clone
RG231782

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251917) Human Tagged ORF Clone
RG231805

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251918) Human Tagged ORF Clone
RG231806

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_001251921) Human Tagged ORF Clone
RG231928

USD 460.00

3 Weeks

RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAP1B (NM_015646) Human Untagged Clone
SC114605

USD 310.00

In Stock

RAP1B (untagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RAP1B (NM_015646) Human Tagged ORF Clone
RC221678L1

USD 768.00

In Stock

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RAP1B (NM_015646) Human Tagged ORF Clone
RC221678L2

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone
RC221793L1

USD 620.00

In Stock

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RAP1B (NM_001010942) Human Tagged ORF Clone
RC221793L2

USD 620.00

3 Weeks

Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RAP1B (NM_001010942) Human Over-expression Lysate
LC423244

USD 121.00

In Stock

RAP1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAP1B (NM_015646) Human Recombinant Protein
TP760456

USD 215.00

In Stock

Purified recombinant protein of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
RAP1B (C-term) Rabbit Polyclonal Antibody
AP53579PU-N

USD 450.00

2 Weeks

RAP1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 149-178 amino acids from the C-terminal region of Human RAP1B.
RAP1B (NM_001010942) Human Over-expression Lysate
LY425291

USD 396.00

5 Days

Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAP1B Rabbit Polyclonal Antibody
TA336122

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAP1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ
RAP1B (1-181, His-tag) Human Protein
AR09831PU-L

USD 1,105.00

2 Weeks

RAP1B (1-181, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
RAP1B (1-181, His-tag) Human Protein
AR09831PU-N

USD 415.00

2 Weeks

RAP1B (1-181, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
RAP1B (NM_015646) Human Over-expression Lysate
LC402456

USD 121.00

2 Weeks

RAP1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAP1B (NM_001010942) Human Over-expression Lysate
LC425291

USD 121.00

2 Weeks

RAP1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAP1B (NM_015646) Human Over-expression Lysate
LY402456

USD 396.00

5 Days

Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAP1B (NM_001010942) Human Over-expression Lysate
LY423244

USD 396.00

5 Days

Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY423244 is the same product as LY425291.
RAP1B (NM_001010942) Human Mass Spec Standard
PH321793

USD 2,055.00

3 Weeks

RAP1B MS Standard C13 and N15-labeled recombinant protein (NP_001010942)

Tag C-Myc/DDK
Expression Host HEK293
RAP1B (NM_001010942) Human Untagged Clone
SC301546

USD 420.00

3 Weeks

RAP1B (untagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RAP1B (NM_001251917) Human Untagged Clone
SC330246

USD 310.00

3 Weeks

RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3

Vector pCMV6 series
Tag Tag Free
RAP1B (NM_001251918) Human Untagged Clone
SC330247

USD 310.00

3 Weeks

RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4

Vector pCMV6 series
Tag Tag Free
RAP1B (NM_001251921) Human Untagged Clone
SC330248

USD 310.00

3 Weeks

RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5

Vector pCMV6 series
Tag Tag Free
RAP1B (NM_001251922) Human Untagged Clone
SC330249

USD 310.00

3 Weeks

RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6

Vector pCMV6 series
Tag Tag Free
RAP1B Rabbit Polyclonal Antibody
TA323457

USD 345.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B Rabbit Polyclonal Antibody
TA323458

USD 345.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B ICC Control Block
TB421678

USD 1,070.00

4 Weeks

Transient overexpression of RAP1B (NM_015646) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RAP1B ICC Control Block
TB421793

USD 1,070.00

4 Weeks

Transient overexpression of RAP1B (NM_001010942) in HEK293T cells paraffin embedded controls for ICC/IHC staining