Germany
Japan
United Kingdom
China
GNA12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, GNA12 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (untagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNA12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNA12 antibody: synthetic peptide directed towards the middle region of human GNA12. Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF |
Rabbit Polyclonal Anti-GNA12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNA12 antibody is: synthetic peptide directed towards the C-terminal region of Human GNA12. Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH |
GNA12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001282440) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001282441) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001293092) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001282440) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001282441) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001293092) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GNA12
Pathways
- Long-term depression