RAP1B (Myc-DDK-tagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (Myc-DDK-tagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (Myc-DDK-tagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAP1B (Myc-DDK tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAP1B (mGFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (Myc-DDK tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (GFP-tagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAP1B (untagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RAP1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
RAP1B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 149-178 amino acids from the C-terminal region of Human RAP1B. |
Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-RAP1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
RAP1B (1-181, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
RAP1B (1-181, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
RAP1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RAP1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RAP1B MS Standard C13 and N15-labeled recombinant protein (NP_001010942)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RAP1B (untagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
Anti-RAP1B Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RAP1B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of RAP1B (NM_015646) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001010942) in HEK293T cells paraffin embedded controls for ICC/IHC staining