Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
AASS (NM_005763) Human Tagged ORF Clone
RC224831

USD 1,030.00

In Stock

AASS (Myc-DDK-tagged)-Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASS (NM_005763) Human Tagged ORF Clone
RC224831L3

USD 1,230.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone Lentiviral Particle
RC224831L3V

USD 1,430.00

6 Weeks

Lenti ORF particles, AASS (Myc-DDK tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone
RC224831L4

USD 1,230.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone Lentiviral Particle
RC224831L4V

USD 1,430.00

6 Weeks

Lenti ORF particles, AASS (mGFP-tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone
RG224831

USD 1,130.00

3 Weeks

AASS (GFP-tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASS Rabbit Polyclonal Antibody
TA315023

USD 345.00

In Stock

Rabbit polyclonal anti-AASS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human AASS.
AASS (C-term) Rabbit Polyclonal Antibody
AP50013PU-N

USD 450.00

2 Weeks

AASS (C-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 812-841 amino acids from the C-terminal region of human AASS.
AASS Rabbit Polyclonal Antibody
TA343313

USD 375.00

5 Days

Rabbit Polyclonal Anti-AASS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASS antibody is: synthetic peptide directed towards the C-terminal region of Human AASS. Synthetic peptide located within the following region: HHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTP
AASS (NM_005763) Human Untagged Clone
SC314936

USD 1,880.00

3 Weeks

AASS (untagged)-Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASS (NM_005763) ICC Control Block
TB424831

USD 1,680.00

4 Weeks

Transient overexpression of AASS (NM_005763) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASS Cytosection
TS424831

USD 225.00

4 Weeks

Transient overexpression of AASS (NM_005763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AASS Cytosection
TS424831P5

USD 889.00

4 Weeks

Transient overexpression of AASS (NM_005763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack