Products

cDNA Clones (22)
Proteins (14)
Antibodies (3)
Jump to Filters
View as table Download
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone
RC219200

USD 1,230.00

In Stock

EHMT2 (Myc-DDK-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone Lentiviral Particle
RC219200L1V

USD 1,630.00

3 Weeks

Lenti ORF particles, EHMT2 (Myc-DDK tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone Lentiviral Particle
RC219200L2V

USD 1,630.00

6 Weeks

Lenti ORF particles, EHMT2 (mGFP-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone Lentiviral Particle
RC224625L1V

USD 1,740.00

3 Weeks

Lenti ORF particles, EHMT2 (Myc-DDK-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone Lentiviral Particle
RC224625L2V

USD 1,740.00

6 Weeks

Lenti ORF particles, EHMT2 (mGFP-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone
RC224625

USD 1,340.00

In Stock

EHMT2 (Myc-DDK-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone
RG219200

USD 1,350.00

In Stock

EHMT2 (GFP-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone
RC219200L3

USD 1,430.00

3 Weeks

Lenti ORF clone of Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone Lentiviral Particle
RC219200L3V

USD 1,630.00

5 Weeks

Lenti ORF particles, EHMT2 (Myc-DDK tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone
RC219200L4

USD 1,430.00

3 Weeks

Lenti ORF clone of Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone Lentiviral Particle
RC219200L4V

USD 1,630.00

7 Weeks

Lenti ORF particles, EHMT2 (mGFP-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone
RC224625L3

USD 1,540.00

3 Weeks

Lenti-ORF clone of EHMT2 (Myc-DDK-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone Lentiviral Particle
RC224625L3V

USD 1,740.00

11 Weeks

Lenti ORF particles, EHMT2 (Myc-DDK-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone Lentiviral Particle
RC224625L4V

USD 1,740.00

11 Weeks

Lenti ORF particles, EHMT2 (mGFP-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_001289413) Human Tagged ORF Clone
RC240065

USD 1,290.00

5 Weeks

EHMT2 (myc-DDK-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone
RG224625

USD 1,470.00

3 Weeks

EHMT2 (GFP-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EHMT2/G9A (EHMT2) Rabbit Polyclonal Antibody
TA347121

USD 358.00

5 Days

Rabbit Polyclonal G9a Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G9a antibody: mouse G9a (Protein G9a), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein
EHMT2/G9A (EHMT2) Rabbit Polyclonal Antibody
TA327026

USD 380.00

3 Weeks

EHMT2 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EHMT2
EHMT2/G9A (EHMT2) (NM_025256) Human Over-expression Lysate
LC410814

USD 187.00

In Stock

EHMT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EHMT2/G9A (EHMT2) (NM_025256) Human Over-expression Lysate
LY410814

USD 605.00

5 Days

Transient overexpression lysate of euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EHMT2/G9A (EHMT2) (NM_006709) Human Over-expression Lysate
LY416468

USD 605.00

In Stock

Transient overexpression lysate of euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EHMT2/G9A (EHMT2) (NM_025256) Human Tagged ORF Clone
RC219200L2

USD 1,430.00

3 Weeks

Lenti ORF clone of Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Tagged ORF Clone
RC224625L2

USD 1,540.00

3 Weeks

Lenti-ORF clone of EHMT2 (mGFP-tagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EHMT2/G9A (EHMT2) (NM_006709) Human Over-expression Lysate
LC416468

USD 187.00

In Stock

EHMT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EHMT2/G9A (EHMT2) Rabbit Polyclonal Antibody
TA330571

USD 375.00

5 Days

Rabbit Polyclonal Anti-EHMT2 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EHMT2 antibody: synthetic peptide directed towards the N terminal of human EHMT2. Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
EHMT2/G9A (EHMT2) (NM_006709) Human Untagged Clone
SC303814

USD 2,460.00

5 Days

EHMT2 (untagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
EHMT2/G9A (EHMT2) (NM_025256) Human Mass Spec Standard
PH319200

USD 2,055.00

3 Weeks

EHMT2 MS Standard C13 and N15-labeled recombinant protein (NP_079532)

Tag C-Myc/DDK
Expression Host HEK293
EHMT2/G9A (EHMT2) (NM_001289413) Human Tagged ORF Clone
RG240065

USD 1,330.00

2 Weeks

EHMT2 (GFP-tagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EHMT2/G9A (EHMT2) (NM_025256) Human Untagged Clone
SC308777

USD 2,380.00

3 Weeks

EHMT2 (untagged)-Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant NG36/G9a-SPI

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EHMT2/G9A (EHMT2) (NM_001289413) Human Untagged Clone
SC337959

USD 1,250.00

5 Weeks

EHMT2 (untagged) - Human euchromatic histone-lysine N-methyltransferase 2 (EHMT2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EHMT2/G9A (EHMT2) (NM_025256) ICC Control Block
TB419200

USD 1,880.00

4 Weeks

Transient overexpression of EHMT2 (NM_025256) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EHMT2/G9A (EHMT2) (NM_006709) ICC Control Block
TB424625

USD 1,990.00

4 Weeks

Transient overexpression of EHMT2 (NM_006709) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EHMT2/G9A (EHMT2) (NM_001289413) ICC Control Block
TB440065

USD 1,940.00

4 Weeks

Transient overexpression of EHMT2 (NM_001289413) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EHMT2/G9A (EHMT2) Cytosection
TS419200

USD 225.00

4 Weeks

Transient overexpression of EHMT2 (NM_025256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EHMT2/G9A (EHMT2) Cytosection
TS419200P5

USD 889.00

4 Weeks

Transient overexpression of EHMT2 (NM_025256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

EHMT2/G9A (EHMT2) Cytosection
TS424625

USD 225.00

4 Weeks

Transient overexpression of EHMT2 (NM_006709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EHMT2/G9A (EHMT2) Cytosection
TS424625P5

USD 889.00

4 Weeks

Transient overexpression of EHMT2 (NM_006709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

EHMT2/G9A (EHMT2) ICC Control Sections
TS440065P5

USD 889.00

4 Weeks

Transient overexpression of EHMT2 (NM_001289413) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack