EHMT2/G9A (EHMT2) Rabbit Polyclonal Antibody

CAT#: TA330571

Rabbit Polyclonal Anti-EHMT2 Antibody

Product Images

WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

• 

  WB Suggested Anti-EHMT2 Antibody ; Positive Control: Lane 1: 30ug human RKO lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680; Secondry Antibody Dilution : 1:5000; Submitted by: Dr. Syed Morshed

• 

  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, assay
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EHMT2 antibody: synthetic peptide directed towards the N terminal of human EHMT2. Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 132 kDa
• Gene Name: euchromatic histone lysine methyltransferase 2
• Database Link:
  NP_006700
  Entrez Gene 10919 Human
  UniProt ID Q96KQ7
• Background: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction. There are three alternatively spliced transcript variants of this gene but only two are fully described.
• Synonyms: BAT8; C6orf30; G9A; GAT8; KMT1C; NG36
• Note: Human: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 79%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysine degradation