Products

cDNA Clones (15)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
TMLHE (NM_018196) Human Tagged ORF Clone
RC214667

USD 420.00

In Stock

TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TMLHE (NM_018196) Human Tagged ORF Clone
RG214667

USD 460.00

In Stock

TMLHE (GFP-tagged) - Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TMLHE (NM_018196) Human Tagged ORF Clone
RC214667L3

USD 620.00

3 Weeks

Lenti-ORF clone of TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_018196) Human Tagged ORF Clone Lentiviral Particle
RC214667L3V

USD 820.00

6 Weeks

Lenti ORF particles, TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_018196) Human Tagged ORF Clone
RC214667L4

USD 620.00

3 Weeks

Lenti-ORF clone of TMLHE (mGFP-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_018196) Human Tagged ORF Clone Lentiviral Particle
RC214667L4V

USD 820.00

6 Weeks

Lenti ORF particles, TMLHE (mGFP-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_001184797) Human Tagged ORF Clone
RC229965

USD 420.00

3 Weeks

TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TMLHE (NM_001184797) Human Tagged ORF Clone
RC229965L3

USD 620.00

8 Weeks

Lenti-ORF clone of TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_001184797) Human Tagged ORF Clone Lentiviral Particle
RC229965L3V

USD 820.00

11 Weeks

Lenti ORF particles, TMLHE (Myc-DDK-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_001184797) Human Tagged ORF Clone
RC229965L4

USD 620.00

8 Weeks

Lenti-ORF clone of TMLHE (mGFP-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_001184797) Human Tagged ORF Clone Lentiviral Particle
RC229965L4V

USD 820.00

11 Weeks

Lenti ORF particles, TMLHE (mGFP-tagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TMLHE (NM_001184797) Human Tagged ORF Clone
RG229965

USD 460.00

3 Weeks

TMLHE (GFP-tagged) - Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TMLHE Rabbit Polyclonal Antibody
TA344912

USD 475.00

5 Days

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG
TMLHE Rabbit Polyclonal Antibody
TA344913

USD 475.00

5 Days

Rabbit Polyclonal Anti-TMLHE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMLHE antibody: synthetic peptide directed towards the middle region of human TMLHE. Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV
TMLHE (NM_018196) Human Over-expression Lysate
LC413241

USD 187.00

In Stock

TMLHE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TMLHE (NM_018196) Human Untagged Clone
SC111322

USD 710.00

In Stock

TMLHE (untagged)-Human trimethyllysine hydroxylase, epsilon (TMLHE), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TMLHE (BC025269) Human Untagged Clone
SC123551

USD 310.00

In Stock

TMLHE (untagged)-Human trimethyllysine hydroxylase, epsilon (cDNA clone MGC:39168 IMAGE:3689631), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TMLHE (N-term) Rabbit Polyclonal Antibody
AP54290PU-N

USD 450.00

2 Weeks

TMLHE (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 123-153 amino acids from the N-terminal region of human TMLHE
TMLHE Rabbit Polyclonal Antibody
TA309022

USD 415.00

5 Days

Rabbit polyclonal antibody to TMLHE (trimethyllysine hydroxylase, epsilon)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 115 and 397 of TMLHE (Uniprot ID#Q9NVH6)
TMLHE (NM_001184797) Human Untagged Clone
SC328603

USD 760.00

3 Weeks

TMLHE (untagged)-Human trimethyllysine hydroxylase epsilon (TMLHE) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TMLHE (NM_018196) ICC Control Block
TB414667

USD 1,070.00

4 Weeks

Transient overexpression of TMLHE (NM_018196) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TMLHE (NM_001184797) ICC Control Block
TB429965

USD 1,070.00

4 Weeks

Transient overexpression of TMLHE (NM_001184797) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TMLHE Cytosection
TS414667

USD 225.00

4 Weeks

Transient overexpression of TMLHE (NM_018196) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TMLHE Cytosection
TS414667P5

USD 889.00

4 Weeks

Transient overexpression of TMLHE (NM_018196) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TMLHE ICC Control Sections
TS429965P5

USD 889.00

4 Weeks

Transient overexpression of TMLHE (NM_001184797) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack