Products

Primary Antibodies (10)
View as table Download

LIMPII (SCARB2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SCARB2 antibody was raised against 16 amino acid peptide from near the center of human LIMP2

Rabbit Polyclonal LIMP2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIMP2 antibody was raised against a 16 amino acid peptide from near the center of human LIMP2.

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]

Rabbit Polyclonal LIMP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen LIMP2 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human LIMP2.

Rabbit Polyclonal LIMPII/SR-B2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Hamster
Conjugation Unconjugated
Immunogen A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114]

Goat Anti-LIMP2 / SCARB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKANIQFGDNGTTIS, from the internal region of the protein sequence according to NP_005497.1.

SCARB1 / SR-BI (aa238-250) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (NGLSKVDFWHSDQ)

SCARB1 / SR-BI Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen C Terminus (TSAPKGSVLQEAK)

Rabbit Polyclonal Anti-SCARB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCARB2 antibody is: synthetic peptide directed towards the C-terminal region of Human SCARB2. Synthetic peptide located within the following region: KSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPL

SCARB2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated