Products

cDNA Clones (29)
Proteins (12)
Antibodies (5)
Jump to Filters
View as table Download
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150

USD 610.00

In Stock

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068

USD 610.00

In Stock

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150L3

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone Lentiviral Particle
RC213150L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150L4

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone Lentiviral Particle
RC213150L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068L3

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone Lentiviral Particle
RC221068L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068L4

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone Lentiviral Particle
RC221068L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127

USD 610.00

4 Weeks

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127L3

USD 810.00

4 Weeks

Lenti-ORF clone of ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone Lentiviral Particle
RC221127L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127L4

USD 810.00

4 Weeks

Lenti-ORF clone of ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone Lentiviral Particle
RC221127L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_001243014) Human Tagged ORF Clone
RC234709

USD 720.00

5 Weeks

ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243013) Human Tagged ORF Clone
RC234747

USD 610.00

5 Weeks

ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RG213150

USD 670.00

3 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RG221068

USD 670.00

3 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RG221127

USD 670.00

5 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243014) Human Tagged ORF Clone
RG234709

USD 790.00

5 Weeks

ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243013) Human Tagged ORF Clone
RG234747

USD 670.00

5 Weeks

ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (BC017348) Human Untagged Clone
SC123606

USD 310.00

In Stock

ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (cDNA clone MGC:29663 IMAGE:5014247), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCB9 Rabbit Polyclonal Antibody
TA331839

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW
ABCB9 Goat Polyclonal Antibody
TA305813

USD 375.00

5 Days

Goat Anti-ABCB9 / TAPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1.
ABCB9 Rabbit Polyclonal Antibody
TA310140

USD 205.00

3 Weeks

Rabbit anti-ABCB9 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCB9.
ABCB9 (NM_203444) Human Untagged Clone
SC308182

USD 1,560.00

3 Weeks

ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCB9 (NM_019625) Human Untagged Clone
SC308840

USD 1,560.00

3 Weeks

ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCB9 (AL833963) Human Untagged Clone
SC312902

USD 960.00

3 Weeks

(untagged)-Human mRNA, cDNA DKFZp547O175 (from clone DKFZp547O175)

Vector pCMV6 series
Tag Tag Free
ABCB9 (NM_019624) Human Untagged Clone
SC314542

USD 1,460.00

5 Weeks

ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ABCB9 (NM_001243013) Human Untagged Clone
SC331939

USD 710.00

5 Weeks

ABCB9 (untagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6

Vector pCMV6 series
Tag Tag Free
ABCB9 (NM_001243014) Human Untagged Clone
SC331940

USD 690.00

5 Weeks

ABCB9 (untagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5

Vector pCMV6 series
Tag Tag Free
ABCB9 Rabbit Polyclonal Antibody
TA322279

USD 345.00

In Stock

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9
ABCB9 Rabbit Polyclonal Antibody
TA324185

USD 345.00

4 Weeks

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ABCB9, swissprot No.:Q9NP78-2.
ABCB9 (NM_019625) ICC Control Block
TB413150

USD 1,260.00

4 Weeks

Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCB9 (NM_203444) ICC Control Block
TB421068

USD 1,260.00

4 Weeks

Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCB9 (NM_019624) ICC Control Block
TB421127

USD 1,260.00

4 Weeks

Transient overexpression of ABCB9 (NM_019624) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCB9 (NM_001243014) ICC Control Block
TB434709

USD 1,370.00

4 Weeks

Transient overexpression of ABCB9 (NM_001243014) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCB9 (NM_001243013) ICC Control Block
TB434747

USD 1,260.00

4 Weeks

Transient overexpression of ABCB9 (NM_001243013) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCB9 Cytosection
TS413150

USD 225.00

4 Weeks

Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ABCB9 Cytosection
TS413150P5

USD 889.00

4 Weeks

Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCB9 Cytosection
TS421068

USD 225.00

4 Weeks

Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ABCB9 Cytosection
TS421068P5

USD 889.00

4 Weeks

Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCB9 ICC Control Sections
TS421127P5

USD 889.00

4 Weeks

Transient overexpression of ABCB9 (NM_019624) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCB9 ICC Control Sections
TS434709P5

USD 889.00

4 Weeks

Transient overexpression of ABCB9 (NM_001243014) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCB9 ICC Control Sections
TS434747P5

USD 889.00

4 Weeks

Transient overexpression of ABCB9 (NM_001243013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack