ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (cDNA clone MGC:29663 IMAGE:5014247), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ABCB9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW |
Goat Anti-ABCB9 / TAPL Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1. |
Rabbit anti-ABCB9 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCB9. |
ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
ABCB9 (untagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
ABCB9 (untagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ABCB9, swissprot No.:Q9NP78-2. |
Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB9 (NM_019624) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB9 (NM_001243014) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB9 (NM_001243013) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCB9 (NM_019625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCB9 (NM_203444) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB9 (NM_019624) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB9 (NM_001243014) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB9 (NM_001243013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack