AP1M2 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AP1M2 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, AP1M2 (Myc-DDK tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, AP1M2 (mGFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AP1M2 (Myc-DDK tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AP1M2 (mGFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AP1M2 (myc-DDK-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AP1M2 (GFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
AP1M2 (untagged)-Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AP1M2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP1M2 antibody: synthetic peptide directed towards the N terminal of human AP1M2. Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL |
AP1M2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of adaptor-related protein complex 1, mu 2 subunit (AP1M2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AP1M2 (GFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AP1M2 (untagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AP1M2 (NM_001300887) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AP1M2 (NM_001300887) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack