Products

View as table Download

AP1M2 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, AP1M2 (Myc-DDK tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, AP1M2 (mGFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP1M2 (Myc-DDK tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP1M2 (mGFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

AP1M2 (myc-DDK-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AP1M2 (GFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

AP1M2 (untagged)-Human adaptor-related protein complex 1, mu 2 subunit (AP1M2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-AP1M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1M2 antibody: synthetic peptide directed towards the N terminal of human AP1M2. Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

AP1M2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of adaptor-related protein complex 1, mu 2 subunit (AP1M2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AP1M2 (GFP-tagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AP1M2 (untagged) - Human adaptor-related protein complex 1, mu 2 subunit (AP1M2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of AP1M2 (NM_001300887) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of AP1M2 (NM_005498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of AP1M2 (NM_001300887) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack