AP3S1 (Myc-DDK-tagged)-Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AP3S1 (Myc-DDK-tagged)-Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AP3S1 (GFP-tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AP3S1 (Myc-DDK tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AP3S1 (mGFP-tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of adaptor-related protein complex 3, sigma 1 subunit (AP3S1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AP3S1 (untagged)-Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal AP3S1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AP3S1 antibody was raised against a 19 amino acid synthetic peptide near the center of human AP3S1. |
AP3S1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of human AP3S1 |
AP3S1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-AP3S1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the N terminal of human AP3S1. Synthetic peptide located within the following region: IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE |
Rabbit Polyclonal Anti-AP3S1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the C terminal of human AP3S1. Synthetic peptide located within the following region: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP |
AP3 complex subunit sigma-1 / AP3S1 (1-193, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
AP3 complex subunit sigma-1 / AP3S1 (1-193, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack