Products

View as table Download

USD 98.00

USD 390.00

In Stock

AP3S1 (Myc-DDK-tagged)-Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

AP3S1 (GFP-tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP3S1 (Myc-DDK tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP3S1 (mGFP-tagged) - Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of adaptor-related protein complex 3, sigma 1 subunit (AP3S1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AP3S1 (untagged)-Human adaptor-related protein complex 3, sigma 1 subunit (AP3S1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal AP3S1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AP3S1 antibody was raised against a 19 amino acid synthetic peptide near the center of human AP3S1.

AP3S1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of human AP3S1

AP3S1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-AP3S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the N terminal of human AP3S1. Synthetic peptide located within the following region: IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE

Rabbit Polyclonal Anti-AP3S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the C terminal of human AP3S1. Synthetic peptide located within the following region: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP

AP3 complex subunit sigma-1 / AP3S1 (1-193, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

AP3 complex subunit sigma-1 / AP3S1 (1-193, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

USD 1,040.00

4 Weeks

Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of AP3S1 (NM_001284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack