Products

cDNA Clones (8)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
AP4M1 (NM_004722) Human Tagged ORF Clone
RC205800

USD 480.00

3 Weeks

AP4M1 (Myc-DDK-tagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP4M1 (NM_004722) Human Tagged ORF Clone
RC205800L3

USD 680.00

3 Weeks

Lenti-ORF clone of AP4M1 (Myc-DDK-tagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP4M1 (NM_004722) Human Tagged ORF Clone Lentiviral Particle
RC205800L3V

USD 880.00

6 Weeks

Lenti ORF particles, AP4M1 (Myc-DDK-tagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP4M1 (NM_004722) Human Tagged ORF Clone
RC205800L4

USD 680.00

3 Weeks

Lenti-ORF clone of AP4M1 (mGFP-tagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP4M1 (NM_004722) Human Tagged ORF Clone Lentiviral Particle
RC205800L4V

USD 880.00

6 Weeks

Lenti ORF particles, AP4M1 (mGFP-tagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP4M1 (NM_004722) Human Tagged ORF Clone
RG205800

USD 530.00

4 Weeks

AP4M1 (GFP-tagged) - Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP4M1 (NM_004722) Human Untagged Clone
SC320509

USD 310.00

In Stock

AP4M1 (untagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
AP4M1 Rabbit Polyclonal Antibody
TA308218

USD 415.00

5 Days

Rabbit Polyclonal antibody to AP4M1 (adaptor-related protein complex 4, mu 1 subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 70 and 295 of AP4M1 (Uniprot ID#O00189)
AP4M1 (NM_004722) Human Untagged Clone
SC111102

USD 310.00

In Stock

AP4M1 (untagged)-Human adaptor-related protein complex 4, mu 1 subunit (AP4M1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
AP4M1 Rabbit Polyclonal Antibody
TA332088

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP4M1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP4M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4M1. Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS
AP4M1 (NM_004722) ICC Control Block
TB405800

USD 1,130.00

4 Weeks

Transient overexpression of AP4M1 (NM_004722) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AP4M1 Cytosection
TS405800

USD 225.00

4 Weeks

Transient overexpression of AP4M1 (NM_004722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AP4M1 Cytosection
TS405800P5

USD 889.00

4 Weeks

Transient overexpression of AP4M1 (NM_004722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack