Germany
Japan
United Kingdom
China
ATP6V0A1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ATP6V0A1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0A1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0A1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ATP6V0A1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ATP6V0A1 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A1 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATP6V0A1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0A1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0A1 (untagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ATP6V0A1 (untagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 2
| Vector | pCMV6-AC-Myc-DDK |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
Rabbit Polyclonal Anti-ATP6V0A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A1 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A1. Synthetic peptide located within the following region: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
ATP6V0A1 (untagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ATP6V0A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ATP6V0A1 MS Standard C13 and N15-labeled recombinant protein (NP_005168)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ATP6V0A1 (NM_005177) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0A1 (NM_001130021) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0A1 (NM_001130020) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0A1 (NM_005177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0A1 (NM_005177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP6V0A1 (NM_001130021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0A1 (NM_001130021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP6V0A1 (NM_001130020) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0A1 (NM_001130020) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ATP6V0A1
Pathways
- Lysosome