Germany
Japan
United Kingdom
China
ATP6V0A1 Rabbit Polyclonal Antibody
Product Images
Other products for "ATP6V0A1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB, IF |
| Reactivities | Human, Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 96 kDa |
| Gene Name | ATPase H+ transporting V0 subunit a1 |
| Database Link | |
| Background | Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle. |
| Synonyms | a1; ATP6N1; ATP6N1A; Stv1; Vph1; VPP1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Human: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.