FUCA1 (Myc-DDK-tagged)-Human fucosidase, alpha-L- 1, tissue (FUCA1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FUCA1 (Myc-DDK-tagged)-Human fucosidase, alpha-L- 1, tissue (FUCA1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human fucosidase, alpha-L- 1, tissue (FUCA1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FUCA1 (GFP-tagged) - Human fucosidase, alpha-L- 1, tissue (FUCA1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human fucosidase, alpha-L- 1, tissue (FUCA1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human fucosidase, alpha-L- 1, tissue (FUCA1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human fucosidase, alpha-L- 1, tissue (FUCA1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
FUCA1 (untagged)-Human fucosidase, alpha-L- 1, tissue (FUCA1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human fucosidase, alpha-L- 1, tissue (FUCA1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of fucosidase, alpha-L- 1, tissue (FUCA1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-FUCA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the N terminal of human FUCA1. Synthetic peptide located within the following region: PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL |
FUCA1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human FUCA1 |
Rabbit Polyclonal Anti-FUCA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the middle region of human FUCA1. Synthetic peptide located within the following region: TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL |
FUCA1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
FUCA1 MS Standard C13 and N15-labeled recombinant protein (NP_000138)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
FUCA1 (untagged)-Human fucosidase, alpha-L- 1, tissue (FUCA1)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-FUCA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FUCA1 |
Transient overexpression of FUCA1 (NM_000147) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FUCA1 (NM_000147) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FUCA1 (NM_000147) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack