Germany
Japan
United Kingdom
China
SCARB2 (Myc-DDK-tagged)-Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, SCARB2 (mGFP-tagged) - Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human scavenger receptor class B, member 2 (SCARB2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, SCARB2 (Myc-DDK tagged) - Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
SCARB2 (GFP-tagged) - Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, SCARB2 (Myc-DDK tagged) - Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, SCARB2 (mGFP-tagged) - Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SCARB2 (Myc-DDK tagged) - Homo sapiens scavenger receptor class B, member 2 (SCARB2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SCARB2 (GFP-tagged) - Homo sapiens scavenger receptor class B, member 2 (SCARB2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SCARB2 (untagged)-Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SCARB2 (untagged)-Human scavenger receptor class B, member 2 (SCARB2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SCARB2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal LIMPII/SR-B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114] |
Transient overexpression lysate of scavenger receptor class B, member 2 (SCARB2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SCARB2 MS Standard C13 and N15-labeled recombinant protein (NP_005497)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Goat Anti-LIMP2 / SCARB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKANIQFGDNGTTIS, from the internal region of the protein sequence according to NP_005497.1. |
SCARB1 / SR-BI (aa238-250) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (NGLSKVDFWHSDQ) |
SCARB1 / SR-BI Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C Terminus (TSAPKGSVLQEAK) |
Rabbit Polyclonal Anti-SCARB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCARB2 antibody is: synthetic peptide directed towards the C-terminal region of Human SCARB2. Synthetic peptide located within the following region: KSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPL |
SCARB2 (untagged) - Homo sapiens scavenger receptor class B, member 2 (SCARB2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
SCARB2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of SCARB2 (NM_005506) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SCARB2 (NM_001204255) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human scavenger receptor class B, member 2 (SCARB2)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human scavenger receptor class B, member 2 (SCARB2)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human scavenger receptor class B, member 2 (SCARB2)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human scavenger receptor class B, member 2 (SCARB2)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of SCARB2 (NM_005506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SCARB2 (NM_005506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SCARB2 (NM_001204255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SCARB2
Pathways
- Lysosome