MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pCMV6-AC-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pCMV6-AC-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,990.00
6 Weeks
Lenti ORF particles, MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,990.00
3 Weeks
Lenti ORF particles, MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,990.00
7 Weeks
Lenti ORF particles, MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,990.00
5 Weeks
Lenti ORF particles, MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP3K1 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP3K1 (untagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAP3K1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MAP3K1 (untagged)-Kinase deficient mutant (K1108M) of Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-MAP3K1 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAP3K1. |
Rabbit anti Mekk-1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAP3K1 MS Standard C13 and N15-labeled recombinant protein (NP_005912)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack