Products

View as table Download

FZD10 (Myc-DDK-tagged)-Human frizzled family receptor 10 (FZD10)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

FZD10 (GFP-tagged) - Human frizzled family receptor 10 (FZD10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD10 (untagged)-Human frizzled family receptor 10 (FZD10)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of frizzled homolog 10 (Drosophila) (FZD10)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal anti-FZD10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD10.

Rabbit Polyclonal Anti-FZD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Lenti ORF clone of Human frizzled family receptor 10 (FZD10), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

FZD10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Frizzled-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen

Anti-FZD10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10

FZD10 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack