Products

cDNA Clones (10)
Antibodies (8)
Proteins (5)
Jump to Filters
View as table Download
Frizzled 4 (FZD4) (NM_012193) Human Tagged ORF Clone
RC217286

USD 480.00

In Stock

FZD4 (Myc-DDK-tagged)-Human frizzled family receptor 4 (FZD4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Frizzled 4 (FZD4) (NM_012193) Human Untagged Clone
SC115479

USD 760.00

In Stock

FZD4 (untagged)-Human frizzled family receptor 4 (FZD4)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Frizzled 4 (FZD4) (NM_012193) Human Tagged ORF Clone
RG217286

USD 530.00

In Stock

FZD4 (GFP-tagged) - Human frizzled family receptor 4 (FZD4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 4 (FZD4) (NM_012193) Human Tagged ORF Clone
RC217286L4

USD 680.00

In Stock

Lenti ORF clone of Human frizzled family receptor 4 (FZD4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA344072

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA321813

USD 345.00

In Stock

Anti-FZD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4
Frizzled 4 (FZD4) (NM_012193) Human Over-expression Lysate
LY402165

USD 605.00

In Stock

Transient overexpression lysate of frizzled homolog 4 (Drosophila) (FZD4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 4 (FZD4) Goat Polyclonal Antibody
TA303333

USD 375.00

2 Weeks

Goat Polyclonal Antibody against FZD4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DEEERRCDPIRIS, from the internal region of the protein sequence according to NP_036325.2.
Frizzled 4 (FZD4) (NM_012193) Human Over-expression Lysate
LC402165

USD 187.00

In Stock

FZD4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 4 (FZD4) (NM_012193) Human Tagged ORF Clone
RC217286L2

USD 680.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 4 (FZD4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312351

USD 345.00

In Stock

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.
Frizzled 4 (FZD4) (C-term) Rabbit Polyclonal Antibody
AP51748PU-N

USD 450.00

2 Weeks

Frizzled 4 (FZD4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 501~531 amino acids from the C-terminal region of Human CD344 / FZD4 / Frizzled-4
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312352

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.
Frizzled 4 (FZD4) Goat Polyclonal Antibody
TA334184

USD 375.00

5 Days

Goat Anti-FZD4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIRSNLQKDGTKT, from the internal region of the protein sequence according to NP_036325.2.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA321814

USD 345.00

In Stock

Anti-FZD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4
Frizzled 4 (FZD4) (NM_012193) ICC Control Block
TB417286

USD 1,130.00

4 Weeks

Transient overexpression of FZD4 (NM_012193) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 4 (FZD4) Cytosection
TS417286

USD 225.00

4 Weeks

Transient overexpression of FZD4 (NM_012193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Frizzled 4 (FZD4) Cytosection
TS417286P5

USD 889.00

4 Weeks

Transient overexpression of FZD4 (NM_012193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack