Products

cDNA Clones (10)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
Frizzled 7 (FZD7) (NM_003507) Human Tagged ORF Clone
RC204167

USD 480.00

In Stock

FZD7 (Myc-DDK-tagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 7 (FZD7) (NM_003507) Human Tagged ORF Clone
RG204167

USD 530.00

In Stock

FZD7 (GFP-tagged) - Human frizzled family receptor 7 (FZD7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 7 (FZD7) (BC015915) Human Untagged Clone
SC122259

USD 310.00

In Stock

FZD7 (untagged)-Human frizzled homolog 7 (Drosophila) (cDNA clone MGC:20119 IMAGE:4549389), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Frizzled 7 (FZD7) Rabbit Polyclonal Antibody
TA344065

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Frizzled 7 (FZD7) (NM_003507) Human Untagged Clone
SC303322

USD 760.00

In Stock

FZD7 (untagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Frizzled 7 (FZD7) (NM_003507) Human Tagged ORF Clone
RC204167L2

USD 680.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 7 (FZD7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Frizzled 7 (FZD7) Goat Polyclonal Antibody
TA303332

USD 375.00

In Stock

Goat Polyclonal Antibody against FZD7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1.
Frizzled 7 (FZD7) (NM_003507) ICC Control Block
TB404167

USD 1,130.00

4 Weeks

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 7 (FZD7) Cytosection
TS404167

USD 225.00

4 Weeks

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Frizzled 7 (FZD7) Cytosection
TS404167P5

USD 889.00

4 Weeks

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack