FZD7 (Myc-DDK-tagged)-Human frizzled family receptor 7 (FZD7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
FZD7 (Myc-DDK-tagged)-Human frizzled family receptor 7 (FZD7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD7 (GFP-tagged) - Human frizzled family receptor 7 (FZD7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 880.00
3 Weeks
Lenti ORF particles, FZD7 (Myc-DDK tagged) - Human frizzled family receptor 7 (FZD7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, FZD7 (mGFP-tagged) - Human frizzled family receptor 7 (FZD7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 880.00
2 Weeks
Lenti ORF particles, FZD7 (Myc-DDK tagged) - Human frizzled family receptor 7 (FZD7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
FZD7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Fzd7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Fzd7 (mGFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
3 Weeks
Lenti ORF particles, FZD7 (mGFP-tagged) - Human frizzled family receptor 7 (FZD7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FZD7 (untagged)-Human frizzled homolog 7 (Drosophila) (cDNA clone MGC:20119 IMAGE:4549389), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FZD7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Lenti ORF clone of Fzd7 (mGFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
FZD7 (untagged)-Human frizzled family receptor 7 (FZD7)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 7 (FZD7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Fzd7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
FZD7 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
Fzd7 (untagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Fzd7 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
Lenti ORF clone of Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 7 (FZD7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against FZD7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1. |
FZD7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
FZD7 CRISPRa kit - CRISPR gene activation of human frizzled class receptor 7
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Fzd7 CRISPRa kit - CRISPR gene activation of mouse frizzled class receptor 7
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene FZD7
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene FZD7
qPCR primer pairs and template standards against Mus musculus gene Fzd7
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Fzd7
FZD7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human FZD7 (NP_003498.1). |
Modifications | Unmodified |
Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded controls for ICC/IHC staining
FZD7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Fzd7 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Fzd7 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
FZD7 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Fzd7 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack