Products

View as table Download

FZD7 (Myc-DDK-tagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD7 (GFP-tagged) - Human frizzled family receptor 7 (FZD7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

FZD7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404167 is the updated version of KN204167.

Fzd7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506209 is the updated version of KN306209.

Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Fzd7 (mGFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Fzd7 (GFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FZD7 (untagged)-Human frizzled homolog 7 (Drosophila) (cDNA clone MGC:20119 IMAGE:4549389), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Lenti ORF clone of Fzd7 (mGFP-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

FZD7 (untagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Fzd7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

FZD7 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

Fzd7 (untagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Fzd7 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

Lenti ORF clone of Fzd7 (Myc-DDK-tagged) - Mouse frizzled homolog 7 (Drosophila) (Fzd7)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 7 (FZD7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Goat Polyclonal Antibody against FZD7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1.

FZD7 CRISPRa kit - CRISPR gene activation of human frizzled class receptor 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Fzd7 CRISPRa kit - CRISPR gene activation of mouse frizzled class receptor 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene FZD7

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene FZD7

qPCR primer pairs and template standards against Mus musculus gene Fzd7

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Fzd7

FZD7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human FZD7 (NP_003498.1).
Modifications Unmodified

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FZD7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Fzd7 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Fzd7 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

FZD7 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Fzd7 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack