Products

cDNA Clones (20)
Proteins (15)
Antibodies (12)
Jump to Filters
View as table Download
PKC beta 1 (PRKCB) (NM_002738) Human Tagged ORF Clone
RG207217

USD 460.00

In Stock

PRKCB (GFP-tagged) - Human protein kinase C, beta (PRKCB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC beta 1 (PRKCB) (NM_002738) Human Untagged Clone
SC118454

USD 310.00

In Stock

PRKCB (untagged)-Human protein kinase C, beta (PRKCB), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKC beta 1 (PRKCB) (NM_002738) Human Tagged ORF Clone
RC207217L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase C, beta (PRKCB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_002738) Human Tagged ORF Clone Lentiviral Particle
RC207217L3V

USD 820.00

7 Weeks

Lenti ORF particles, PRKCB (Myc-DDK tagged) - Human protein kinase C, beta (PRKCB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_002738) Human Tagged ORF Clone
RC207217L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase C, beta (PRKCB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_212535) Human Tagged ORF Clone
RC220599L3

USD 950.00

3 Weeks

Lenti ORF clone of Human protein kinase C, beta (PRKCB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_212535) Human Tagged ORF Clone Lentiviral Particle
RC220599L3V

USD 1,150.00

7 Weeks

Lenti ORF particles, PRKCB (Myc-DDK tagged) - Human protein kinase C, beta (PRKCB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_212535) Human Tagged ORF Clone
RC220599L4

USD 950.00

3 Weeks

Lenti ORF clone of Human protein kinase C, beta (PRKCB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC beta 1 (PRKCB) (NM_212535) Human Tagged ORF Clone
RG220599

USD 830.00

3 Weeks

PRKCB (GFP-tagged) - Human protein kinase C, beta (PRKCB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA333060

USD 352.00

3 Weeks

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific
PKC beta 1 (PRKCB) (NM_002738) Human Over-expression Lysate
LY419133

USD 396.00

In Stock

Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC beta 1 (PRKCB) (NM_212535) Human Tagged ORF Clone
RC220599L2

USD 950.00

In Stock

Lenti ORF clone of Human protein kinase C, beta (PRKCB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA332954

USD 275.00

3 Weeks

Rabbit anti-PRKCB Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCB
PKC beta 1 (PRKCB) (NM_212535) Human Untagged Clone
SC308645

USD 1,370.00

In Stock

PRKCB (untagged)-Human protein kinase C, beta (PRKCB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKC beta 1 (PRKCB) (NM_002738) Human Untagged Clone
SC323585

USD 760.00

In Stock

PRKCB (untagged)-Kinase deficient mutant (K371M) of Human protein kinase C, beta (PRKCB), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA322962

USD 345.00

4 Weeks

Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ
Modifications Phospho-specific
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA327788

USD 345.00

In Stock

Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661
Modifications Phospho-specific
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA327842

USD 345.00

In Stock

Rabbit Polyclonal PKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB
PKC beta 1 (PRKCB) (NM_002738) Human Over-expression Lysate
LC419133

USD 121.00

In Stock

PRKCB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA302123

USD 450.00

5 Days

Rabbit Polyclonal Antibody against PRKCB1 (C-term)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2.
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA318911

USD 380.00

3 Weeks

Rabbit polyclonal anti-PKC beta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the C-terminus of mouse PKC β1
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
AP20795PU-N

USD 370.00

2 Weeks

PKC beta 1 (PRKCB) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA342146

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA342147

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
PKC beta 1 (PRKCB) Goat Polyclonal Antibody
TA355089

USD 375.00

5 Days

Goat Anti-PRKCB, Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKEFTRQPVELT., from the internal region (near C terminus) of the protein sequence according to NP_997700.1.
PKC beta 1 (PRKCB) (NM_212535) Human Over-expression Lysate
LC403957

USD 187.00

2 Weeks

PRKCB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC beta 1 (PRKCB) (NM_212535) Human Over-expression Lysate
LC431009

USD 187.00

2 Weeks

PRKCB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC beta 1 (PRKCB) (NM_212535) Human Over-expression Lysate
LY403957

USD 605.00

5 Days

Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY403957 is the same product as LY431009.
PKC beta 1 (PRKCB) (NM_212535) Human Over-expression Lysate
LY431009

USD 605.00

5 Days

Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC beta 1 (PRKCB) (NM_002738) Human Mass Spec Standard
PH307217

USD 2,055.00

3 Weeks

PRKCB MS Standard C13 and N15-labeled recombinant protein (NP_002729)

Tag C-Myc/DDK
Expression Host HEK293
PKC beta 1 (PRKCB) (NM_212535) Human Mass Spec Standard
PH320599

USD 2,055.00

3 Weeks

PRKCB MS Standard C13 and N15-labeled recombinant protein (NP_997700)

Tag C-Myc/DDK
Expression Host HEK293
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA350904

USD 345.00

In Stock

Rabbit Polyclonal Anti-PRKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCB
PKC beta 1 (PRKCB) ICC Control Block
TB407217

USD 1,070.00

4 Weeks

Transient overexpression of PRKCB (NM_002738) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PKC beta 1 (PRKCB) ICC Control Block
TB420599

USD 1,400.00

4 Weeks

Transient overexpression of PRKCB (NM_212535) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PKC beta 1 (PRKCB) Cytosection
TS407217

USD 225.00

4 Weeks

Transient overexpression of PRKCB (NM_002738) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PKC beta 1 (PRKCB) Cytosection
TS407217P5

USD 889.00

4 Weeks

Transient overexpression of PRKCB (NM_002738) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PKC beta 1 (PRKCB) Cytosection
TS420599

USD 225.00

4 Weeks

Transient overexpression of PRKCB (NM_212535) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PKC beta 1 (PRKCB) Cytosection
TS420599P5

USD 889.00

4 Weeks

Transient overexpression of PRKCB (NM_212535) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack