Products

View as table Download

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ALDH3A2 (GFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY424751 is the same product as LY424995.

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation HRP