Products

cDNA Clones (42)
Proteins (20)
Antibodies (8)
Jump to Filters
View as table Download
DNMT3B (NM_006892) Human Tagged ORF Clone
RC223206

USD 750.00

In Stock

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DNMT3B (NM_006892) Human Tagged ORF Clone
RG223206

USD 830.00

In Stock

DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_006892) Human Tagged ORF Clone Lentiviral Particle
RC223206L1V

USD 1,150.00

3 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DNMT3B (NM_006892) Human Tagged ORF Clone Lentiviral Particle
RC223206L2V

USD 1,150.00

6 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone Lentiviral Particle
RC223418L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone Lentiviral Particle
RC223418L2V

USD 1,010.00

11 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone
RC223418

USD 610.00

In Stock

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175850) Human Tagged ORF Clone
RG222068

USD 830.00

In Stock

DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175848) Human Tagged ORF Clone
RC221966

USD 750.00

In Stock

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175848) Human Tagged ORF Clone
RC221966L3

USD 950.00

3 Weeks

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175848) Human Tagged ORF Clone Lentiviral Particle
RC221966L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175848) Human Tagged ORF Clone
RC221966L4

USD 950.00

3 Weeks

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175848) Human Tagged ORF Clone Lentiviral Particle
RC221966L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175850) Human Tagged ORF Clone
RC222068

USD 750.00

3 Weeks

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175850) Human Tagged ORF Clone
RC222068L3

USD 950.00

3 Weeks

Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175850) Human Tagged ORF Clone Lentiviral Particle
RC222068L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175850) Human Tagged ORF Clone
RC222068L4

USD 950.00

3 Weeks

Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175850) Human Tagged ORF Clone Lentiviral Particle
RC222068L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_006892) Human Tagged ORF Clone Lentiviral Particle
RC223206L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_006892) Human Tagged ORF Clone
RC223206L4

USD 950.00

In Stock

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_006892) Human Tagged ORF Clone Lentiviral Particle
RC223206L4V

USD 1,150.00

3 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone
RC223418L3

USD 810.00

3 Weeks

Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone Lentiviral Particle
RC223418L3V

USD 1,010.00

11 Weeks

Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone
RC223418L4

USD 810.00

3 Weeks

Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone Lentiviral Particle
RC223418L4V

USD 1,010.00

11 Weeks

Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B (NM_001207056) Human Tagged ORF Clone
RC234733

USD 730.00

5 Weeks

DNMT3B (Myc-DDK tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_001207055) Human Tagged ORF Clone
RC234785

USD 760.00

5 Weeks

DNMT3B (Myc-DDK tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175848) Human Tagged ORF Clone
RG221966

USD 830.00

3 Weeks

DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_175849) Human Tagged ORF Clone
RG223418

USD 670.00

3 Weeks

DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_001207056) Human Tagged ORF Clone
RG234733

USD 800.00

5 Weeks

DNMT3B (GFP-tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B (NM_001207055) Human Tagged ORF Clone
RG234785

USD 840.00

5 Weeks

DNMT3B (GFP-tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNMT3B Rabbit Polyclonal Antibody
TA347116

USD 490.00

5 Days

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein.
DNMT3B (NM_006892) Human Tagged ORF Clone
RC223206L1

USD 1,176.00

In Stock

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DNMT3B (NM_175849) Human Tagged Lenti ORF Clone
RC223418L1

USD 1,008.00

In Stock

Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DNMT3B (NM_006892) Human Untagged Clone
SC111622

USD 1,740.00

In Stock

DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DNMT3B (NM_006892) Human Tagged ORF Clone
RC223206L3

USD 1,176.00

In Stock

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNMT3B Rabbit Polyclonal Antibody
TA347117

USD 358.00

5 Days

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein
DNMT3B (NM_006892) Human Over-expression Lysate
LY416333

USD 605.00

5 Days

Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNMT3B Rabbit Polyclonal Antibody
TA313761

USD 345.00

4 Weeks

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.
DNMT3B (1-50) Rabbit Polyclonal Antibody
AP31351PU-N

USD 440.00

2 Weeks

DNMT3B (1-50) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human DNMT3B (aa 1-50)
DNMT3B Rabbit Polyclonal Antibody
TA327439

USD 275.00

3 Weeks

DNMT3B Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT3B
DNMT3B Rabbit Polyclonal Antibody
TA331002

USD 375.00

5 Days

Rabbit polyclonal Anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC
DNMT3B (NM_006892) Human Tagged ORF Clone
RC223206L2

USD 950.00

3 Weeks

Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DNMT3B (NM_175849) Human Tagged ORF Clone
RC223418L2

USD 810.00

3 Weeks

Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DNMT3B (NM_175849) Human Over-expression Lysate
LY406229

USD 605.00

5 Days

Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNMT3B (NM_175848) Human Untagged Clone
SC124706

USD 1,690.00

In Stock

DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DNMT3B (NM_175849) Human Over-expression Lysate
LC406229

USD 187.00

2 Weeks

DNMT3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNMT3B (NM_006892) Human Over-expression Lysate
LC416333

USD 187.00

2 Weeks

DNMT3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNMT3B (NM_006892) Human Mass Spec Standard
PH323206

USD 2,055.00

3 Weeks

DNMT3B MS Standard C13 and N15-labeled recombinant protein (NP_008823)

Tag C-Myc/DDK
Expression Host HEK293
DNMT3B (NM_175850) Human Untagged Clone
SC307033

USD 1,720.00

5 Weeks

DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6

Vector pCMV6 series
Tag Tag Free