Germany
Japan
United Kingdom
China
DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DNMT3B (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DNMT3B (Myc-DDK tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (Myc-DDK tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (GFP-tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3B (GFP-tagged) - Homo sapiens DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein. |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal Anti-DNMT3B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of DNMT3B (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DNMT3B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DNMT3B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DNMT3B MS Standard C13 and N15-labeled recombinant protein (NP_008823)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
DNMT3B (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 6
| Vector | pCMV6 series |
| Tag | Tag Free |
Active filters
Target Symbol
- DNMT3B
Pathways
- Metabolic pathways