Products

cDNA Clones (24)
Proteins (16)
Antibodies (2)
Jump to Filters
View as table Download
IL4I1 (NM_172374) Human Tagged ORF Clone
RC221972

USD 420.00

In Stock

IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IL4I1 (NM_152899) Human Tagged ORF Clone
RC210310

USD 420.00

In Stock

IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_172374) Human Tagged ORF Clone Lentiviral Particle
RC221972L1V

USD 820.00

3 Weeks

Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone Lentiviral Particle
RC221972L2V

USD 820.00

6 Weeks

Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone
RG221972

USD 460.00

In Stock

IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_001258017) Human Tagged ORF Clone
RC234504

USD 420.00

In Stock

IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_001258018) Human Tagged ORF Clone
RC234505

USD 420.00

In Stock

IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_152899) Human Tagged ORF Clone
RC210310L3

USD 620.00

3 Weeks

Lenti-ORF clone of IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_152899) Human Tagged ORF Clone Lentiviral Particle
RC210310L3V

USD 820.00

6 Weeks

Lenti ORF particles, IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_152899) Human Tagged ORF Clone
RC210310L4

USD 620.00

3 Weeks

Lenti-ORF clone of IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_152899) Human Tagged ORF Clone Lentiviral Particle
RC210310L4V

USD 820.00

6 Weeks

Lenti ORF particles, IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone
RC221972L3

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone Lentiviral Particle
RC221972L3V

USD 820.00

5 Weeks

Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone
RC221972L4

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone Lentiviral Particle
RC221972L4V

USD 820.00

7 Weeks

Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4I1 (NM_152899) Human Tagged ORF Clone
RG210310

USD 460.00

3 Weeks

IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_001258017) Human Tagged ORF Clone
RG234504

USD 460.00

3 Weeks

IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_001258018) Human Tagged ORF Clone
RG234505

USD 460.00

3 Weeks

IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4I1 (NM_172374) Human Tagged ORF Clone
RC221972L1

USD 768.00

In Stock

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IL4I1 (NM_172374) Human Tagged ORF Clone
RC221972L2

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IL4I1 Rabbit Polyclonal Antibody
TA316282

USD 345.00

4 Weeks

Rabbit polyclonal anti-IL4I1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1.
IL4I1 (NM_172374) Human Over-expression Lysate
LC406700

USD 187.00

In Stock

IL4I1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL4I1 (NM_152899) Human Untagged Clone
SC101062

USD 760.00

In Stock

IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
IL4I1 Rabbit Polyclonal Antibody
TA337862

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL4I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS
IL4I1 (NM_172374) Human Mass Spec Standard
PH321972

USD 2,055.00

3 Weeks

IL4I1 MS Standard C13 and N15-labeled recombinant protein (NP_758962)

Tag C-Myc/DDK
Expression Host HEK293
IL4I1 (NM_172374) Human Untagged Clone
SC306765

USD 760.00

3 Weeks

IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
IL4I1 (NM_001258017) Human Untagged Clone
SC332572

USD 600.00

5 Weeks

IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
IL4I1 (NM_001258018) Human Untagged Clone
SC332573

USD 600.00

5 Weeks

IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6 series
Tag Tag Free
IL4I1 (NM_152899) ICC Control Block
TB410310

USD 1,070.00

4 Weeks

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded controls for ICC/IHC staining

IL4I1 (NM_172374) ICC Control Block
TB421972

USD 1,070.00

4 Weeks

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded controls for ICC/IHC staining

IL4I1 (NM_001258017) ICC Control Block
TB434504

USD 1,070.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded controls for ICC/IHC staining

IL4I1 (NM_001258018) ICC Control Block
TB434505

USD 1,070.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded controls for ICC/IHC staining

IL4I1 (NM_152899) Human Recombinant Protein
TP701092

USD 788.00

2 Weeks

Purified recombinant protein of Human interleukin 4 induced 1 (IL4I1), Gln22-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug

Tag C-HIS
Expression Host HEK293
IL4I1 Cytosection
TS410310

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

IL4I1 Cytosection
TS410310P5

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL4I1 Cytosection
TS421972

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

IL4I1 Cytosection
TS421972P5

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL4I1 Cytosection
TS434504

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

IL4I1 Cytosection
TS434504P5

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL4I1 Cytosection
TS434505

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

IL4I1 Cytosection
TS434505P5

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack