Germany
Japan
United Kingdom
China
IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il4i1 (Myc-DDK-tagged) - Mouse interleukin 4 induced 1 (Il4i1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Il4i1 (GFP-tagged) - Mouse interleukin 4 induced 1 (Il4i1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410310 is the updated version of KN210310.
Il4i1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508289 is the updated version of KN308289.
Lenti-ORF clone of IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Il4i1 (mGFP-tagged) - Mouse interleukin 4 induced 1 (Il4i1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il4i1 (GFP-tagged) - Mouse interleukin 4 induced 1 (Il4i1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Il4i1 (untagged) - Mouse interleukin 4 induced 1 (Il4i1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Il4i1 (Myc-DDK-tagged) - Mouse interleukin 4 induced 1 (Il4i1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of interleukin 4 induced 1 (IL4I1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Il4i1 (Myc-DDK-tagged) - Mouse interleukin 4 induced 1 (Il4i1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-IL4I1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
IL4I1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
IL4I1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-IL4I1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
IL4I1 CRISPRa kit - CRISPR gene activation of human interleukin 4 induced 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Il4i1 CRISPRa kit - CRISPR gene activation of mouse interleukin 4 induced 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IL4I1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene IL4I1
qSTAR qPCR primer pairs against Mus musculus gene Il4i1
IL4I1 MS Standard C13 and N15-labeled recombinant protein (NP_758962)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
IL4I1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Il4i1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IL4I1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human IL4I1 (NP_690863.1). |
| Modifications | Unmodified |
Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- IL4I1
Filter by
Species
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Alanine (42)
- Cysteine and methionine metabolism (42)
- Metabolic pathways (42)
- Phenylalanine (42)
- Phenylalanine metabolism (42)
- Tryptophan metabolism (42)
- Tyrosine metabolism (42)
- Valine (42)
- aspartate and glutamate metabolism (42)
- leucine and isoleucine degradation (42)
- tyrosine and tryptophan biosynthesis (42)