Products

cDNA Clones (14)
Proteins (9)
Antibodies (1)
Jump to Filters
View as table Download
NDUFB4 (NM_004547) Human Tagged ORF Clone
RC201574

USD 98.00

USD 390.00

In Stock

NDUFB4 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NDUFB4 (NM_004547) Human Tagged ORF Clone
RG201574

USD 460.00

In Stock

NDUFB4 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFB4 (NM_004547) Human Tagged ORF Clone
RC201574L3

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_004547) Human Tagged ORF Clone Lentiviral Particle
RC201574L3V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFB4 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_004547) Human Tagged ORF Clone
RC201574L4

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_004547) Human Tagged ORF Clone Lentiviral Particle
RC201574L4V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFB4 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone
RC229553

USD 420.00

2 Weeks

NDUFB4 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone
RC229553L3

USD 620.00

8 Weeks

Lenti-ORF clone of NDUFB4 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone Lentiviral Particle
RC229553L3V

USD 820.00

11 Weeks

Lenti ORF particles, NDUFB4 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone
RC229553L4

USD 620.00

8 Weeks

Lenti-ORF clone of NDUFB4 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone Lentiviral Particle
RC229553L4V

USD 820.00

11 Weeks

Lenti ORF particles, NDUFB4 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFB4 (NM_001168331) Human Tagged ORF Clone
RG229553

USD 460.00

3 Weeks

NDUFB4 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFB4 (NM_004547) Human Over-expression Lysate
LY417916

USD 396.00

5 Days

Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NDUFB4 (NM_004547) Human Untagged Clone
SC117304

USD 310.00

In Stock

NDUFB4 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NDUFB4 Rabbit Polyclonal Antibody
TA333970

USD 375.00

5 Days

Rabbit Polyclonal Anti-NDUFB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NDUFB4 Antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFB4. Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
Complex I subunit NDUFB4 (1-87, His-tag) Human Protein
AR50853PU-N

USD 845.00

2 Weeks

Complex I subunit NDUFB4 (1-87, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Complex I subunit NDUFB4 (1-87, His-tag) Human Protein
AR50853PU-S

USD 330.00

2 Weeks

Complex I subunit NDUFB4 (1-87, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
NDUFB4 (NM_004547) Human Over-expression Lysate
LC417916

USD 121.00

2 Weeks

NDUFB4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NDUFB4 (NM_001168331) Human Untagged Clone
SC328191

USD 420.00

2 Weeks

NDUFB4 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex 4 15kDa (NDUFB4) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NDUFB4 ICC Control Block
TB401574

USD 1,040.00

4 Weeks

Transient overexpression of NDUFB4 (NM_004547) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NDUFB4 ICC Control Block
TB429553

USD 1,070.00

4 Weeks

Transient overexpression of NDUFB4 (NM_001168331) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NDUFB4 Cytosection
TS401574

USD 225.00

4 Weeks

Transient overexpression of NDUFB4 (NM_004547) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NDUFB4 Cytosection
TS401574P5

USD 889.00

4 Weeks

Transient overexpression of NDUFB4 (NM_004547) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

NDUFB4 ICC Control Sections
TS429553P5

USD 889.00

4 Weeks

Transient overexpression of NDUFB4 (NM_001168331) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack