Germany
Japan
United Kingdom
China
CYP2C18 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CYP2C18 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2C18 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2C18 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP2C18 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2C18 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP2C18 (mGFP-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2C18 (mGFP-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP2C18 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP2C18 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP2C18 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310335 is the updated version of SC125486.
Rabbit Polyclonal Anti-CYP2C18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
CYP2C18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP2C18 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2C18 |
CYP2C18 MS Standard C13 and N15-labeled recombinant protein (NP_000763)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CYP2C18 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CYP2C18 (NM_000772) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2C18 (NM_001128925) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2C18 (NM_000772) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2C18 (NM_000772) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP2C18 (NM_001128925) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2C18 (NM_001128925) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2C18
Pathways
- Metabolism of xenobiotics by cytochrome P450