CYP2C18 Rabbit Polyclonal Antibody

CAT#: TA346226

Rabbit Polyclonal Anti-CYP2C18 Antibody

Product Images

WB Suggested Anti-CYP2C18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cytochrome P450 family 2 subfamily C member 18
• Database Link:
  NP_000763
  Entrez Gene 1562 Human
  UniProt ID P33260
• Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: 29C; CPCI; CYP2C; CYP2C17; P450-6B; P450IIC17
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Pig: 85%; Horse: 83%; Rabbit: 83%; Sheep: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, P450
• Protein Pathways: Arachidonic acid metabolism, Drug metabolism - cytochrome P450, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism