Germany
Japan
United Kingdom
China
CYP3A4 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadCYP3A4 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CYP3A4 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, CYP3A4 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CYP3A4 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP3A4 (Myc-DDK tagged) - Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A4 (GFP-tagged) - Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, CYP3A4 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, CYP3A4 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
CYP3A4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CYP3A4 MS Standard C13 and N15-labeled recombinant protein (NP_059488)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit polyclonal Cytochrome P450 3A4/5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4/5. |
USD 1,140.00
9 Weeks
Rabbit Polyclonal Anti-CYP3A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |
Sheep polyclonal anti-Cytochrome P450 3A4 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 3A4 |
Rabbit polyclonal anti-Cytochrome P450 (CYP3A4) antibody
| Reactivities | Human |
| Immunogen | Cytochrome P450 (CYP3A4) |
CYP3A4 (untagged) - Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 4 (CYP3A4), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Transient overexpression of CYP3A4 (NM_017460) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A4 (NM_001202855) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A4 (NM_017460) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A4 (NM_017460) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A4 (NM_001202855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A4 (NM_001202855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP3A4
Pathways
- Metabolism of xenobiotics by cytochrome P450