Products

Proteins (20)
cDNA Clones (18)
Antibodies (2)
Jump to Filters
View as table Download
DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
TP301793

USD 823.00

In Stock

Recombinant protein of human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

DNA polymerase delta p50 (POLD2) (NM_001256879) Human Tagged ORF Clone
RC234195

USD 420.00

In Stock

POLD2 (Myc-DDK tagged) - Homo sapiens polymerase (DNA directed), delta 2, accessory subunit (POLD2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DNA polymerase delta p50 (POLD2) (NM_006230) Human Tagged ORF Clone
RG201793

USD 530.00

In Stock

POLD2 (GFP-tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNA polymerase delta p50 (POLD2) (NM_006230) Human Tagged ORF Clone
RC201793L3

USD 680.00

3 Weeks

Lenti ORF clone of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_006230) Human Tagged ORF Clone Lentiviral Particle
RC201793L3V

USD 880.00

6 Weeks

Lenti ORF particles, POLD2 (Myc-DDK tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_006230) Human Tagged ORF Clone
RC201793L4

USD 680.00

3 Weeks

Lenti ORF clone of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_006230) Human Tagged ORF Clone Lentiviral Particle
RC201793L4V

USD 880.00

6 Weeks

Lenti ORF particles, POLD2 (mGFP-tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Tagged ORF Clone
RC225794L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Tagged ORF Clone Lentiviral Particle
RC225794L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLD2 (Myc-DDK tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Tagged ORF Clone Lentiviral Particle
RC225794L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLD2 (mGFP-tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Tagged ORF Clone
RG225794

USD 460.00

3 Weeks

POLD2 (GFP-tagged) - Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNA polymerase delta p50 (POLD2) (NM_001256879) Human Tagged ORF Clone
RG234195

USD 460.00

3 Weeks

POLD2 (GFP-tagged) - Homo sapiens polymerase (DNA directed), delta 2, accessory subunit (POLD2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNA polymerase delta p50 (POLD2) Rabbit Polyclonal Antibody
TA346748

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT
DNA polymerase delta p50 (POLD2) (NM_006230) Human Untagged Clone
SC112691

USD 310.00

In Stock

POLD2 (untagged)-Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DNA polymerase delta p50 (POLD2) (NM_006230) Human Untagged Clone
SC320576

USD 310.00

In Stock

POLD2 (untagged)-Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DNA polymerase delta p50 (POLD2) (NM_006230) Human Over-expression Lysate
LY416786

USD 396.00

5 Days

Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNA polymerase delta p50 (POLD2) Rabbit Polyclonal Antibody
TA325187

USD 450.00

5 Days

Rabbit polyclonal POLD2 Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2.
DNA polymerase delta p50 (POLD2) (NM_006230) Human Over-expression Lysate
LC416786

USD 121.00

2 Weeks

POLD2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Over-expression Lysate
LY426719

USD 396.00

5 Days

Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNA polymerase delta p50 (POLD2) (NM_001127218) Human Untagged Clone
SC323085

USD 760.00

3 Weeks

POLD2 (untagged)-Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DNA polymerase delta p50 (POLD2) ICC Control Block
TB401793

USD 1,130.00

4 Weeks

Transient overexpression of POLD2 (NM_006230) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DNA polymerase delta p50 (POLD2) ICC Control Block
TB425794

USD 1,070.00

4 Weeks

Transient overexpression of POLD2 (NM_001127218) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DNA polymerase delta p50 (POLD2) ICC Control Block
TB434195

USD 1,070.00

4 Weeks

Transient overexpression of POLD2 (NM_001256879) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
TP720925

USD 330.00

3 Weeks

Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-His
Expression Host E. coli
DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
TP720925L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-His
Expression Host E. coli
DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
TP720925M

USD 760.00

3 Weeks

Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-His
Expression Host E. coli
DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
TP720925XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2

Tag C-His
Expression Host E. coli
DNA polymerase delta p50 (POLD2) Cytosection
TS401793

USD 225.00

4 Weeks

Transient overexpression of POLD2 (NM_006230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DNA polymerase delta p50 (POLD2) Cytosection
TS401793P5

USD 889.00

4 Weeks

Transient overexpression of POLD2 (NM_006230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DNA polymerase delta p50 (POLD2) Cytosection
TS425794

USD 225.00

4 Weeks

Transient overexpression of POLD2 (NM_001127218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DNA polymerase delta p50 (POLD2) Cytosection
TS425794P5

USD 889.00

4 Weeks

Transient overexpression of POLD2 (NM_001127218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DNA polymerase delta p50 (POLD2) Cytosection
TS434195

USD 225.00

4 Weeks

Transient overexpression of POLD2 (NM_001256879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DNA polymerase delta p50 (POLD2) Cytosection
TS434195P5

USD 889.00

4 Weeks

Transient overexpression of POLD2 (NM_001256879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack